<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL10877 59219 Portugal 2001 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 65
2 D4T+ DDI+ IDV 161
3 AZT+ DDI+ IDV+ SQV 33

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82T, L90M   L10LI, I13V, K14R, I15V, K20I, E35D, M36I, N37D, R41K, L63LP, H69K, A71V, T74S, L89I, T91TN T96TN
>59219| codons 1-99
PQITLWQRPIVTVRVGGQLIEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFVKVRQYD
QIPIEICGKKVIGSVLVGPTPTNIIGRNIMNQIGCNLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y       E28A, V35T, K43Q, V60I, A98S, K122E, D123S, I135T, K173I, Q174K, T200A, Q207K, R211N, V245Q, E248D, D250E, A272P, T286A, E291D, V292I, I293V, E297A, D324E  
>59219| codons 22-324
KQWPLTAEKIKALTEICTELEQEGKISKIGPENPYNTPIFAIKKKNSTKWRKLVDFRELN
KRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPG
IRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPDIVIYQYMDDLYVGSDLEIGQHRAK
IEELRKHLWNWGFYTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLPDKESWTVNDIQKLV
GKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAELELAENREILKEPVHGVYYDP
SKE

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005