<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL28285 65163 Portugal 2002 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 EFV+ TDF+ D4T NA
2 ATV+ IDV+ DDC+ AZT NA
3 Unknown 37

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151M, M184V A62V, D67DG, V75I, F116Y, K219KE Y181C   K11Q, A33V, V35T, E36D, K49R, V60I, S68G, D121H, K122E, D123S, I135V, S162AD, I167IV, K173T, Q174R, D177E, T200A, I202V, Q207E, R211K, F214FL, V245K, A272P, K277R, T286A, A288T, E291D, V292I, I293V, P294T, S322T, I326V  
>65163| codons 1-333
PISPIETVPVQLKPGMDGPKVKQWPLTEEKIKVLTDICTEMEKEGKISRIGPENPYNTPI
FVIKKKGGTKWRKLIDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSVPL
HESFRKYTAFTIPSVNNETPGIRYQYNVLPMGWKGSPAIFQDSMTKVLEPFRTRNPEIVI
CQYVDDLYVGSDLEIGQHRAKVEELREHLLKWGLTTPDEKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKTLTDIVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLVAEIQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82VA, I84IV, L90M L33F, K43KT, L89V L10V, I13V, K14R, G16E, K20IM, E35G, M36I, R41K, Q61H, C67Y, G68GE, H69Q, I72R  
>65163| codons 1-99
PQITLWQRPVVTVRIEGQLMEALLDTGADDTVFEGINLPGKWTPKMIGGIGGFIKVRQYD
HILIEIYEQKARGTVLVGPTPANVIGRNVMTQIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005