<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL38351 82869 Portugal 2003 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ NFV+ 3TC NA
2 Unknown 101

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35D, M36I, R41K, H69K, V82I, L89M  
>82869| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215Y   K103N   L34I, V35T, T39A, A98S, K122E, D123N, I135L, S162C, K173T, Q174K, D177E, I178L, G196E, T200A, Q207K, R211S, V245Q, E248ED, D250E, A272P, T286A, E291D, V292I, I293V, E297A  
>82869| codons 1-314
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKAITEICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRTKNPELVI
YQYMDDLYVGSDLEIEQHRAKIEELRKHLLSWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAENREILKEPV

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005