<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL19454 80060 Portugal 2003 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 31
2 ABC+EFV+LPV 22
3 Unknown 95

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y   K101EQ, K103KN, Y181C, G190A F227L L34I, V35T, T39L, V60I, A98S, V111VI, K122E, D123NS, K173R, Q174N, D177E, T200A, E203K, Q207ADE, H208HY, R211K, K223E, V245T, D250E, A272P, T286A, E291D, V292I, I293V, E297T, A304E, D324E, I329V L303LRW
>80060| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKAITEICLELEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPSGLQKNKSVTVLDIGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRRNNPEIVI
CQYVDDLYVASDLEIGQHRAKIKELREYLWKWGFYTPDKKHQEEPPLLWMGYELHPDKWT
VQPITLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTTEAE
LEWEENREILKEPVHGVYYDPSKELIAEVQKQG

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005