<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL26473 89488 Portugal 2003 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ SQV+ RTV+ IDV+ EFV+ 3TC+ DDI+ AZT NA
2 3TC+ LPV+ ABC NA
3 Unknown 124

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215Y V75M, K219Q     V35T, E44A, V60I, A98S, S117A, K122E, D123S, I135T, I167IV, K173IT, Q174K, D177G, G196E, T200A, E203K, Q207E, H208Y, R211H, D218E, L228H, V245Q, E248D, D250E, A272P, T286A, E291D, V292VI, I293V, E297A, L301M, D324E, I329V, Q334P W212L
>89488| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKAGKISKIGPENPYNTPI
FAIKKKNSTRWRKLMDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFAVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKVLEPFRTKNPGIVI
YQYVDDLYVGSDLEIEQHRAKIKELREYLLHLGFYTPEQKHQKEPPFHWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
MELAENREILKEPVHGVYYDPSKELIAEVQKQGPG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, I54V, V82F, L90M L89V L10I, I13A, K14R, K20IT, A22AV, E35N, M36I, N37D, R41K, L63P, I66V, H69K, K70KT, A71V, I85IV, Q92K C67CR
>89488| codons 1-99
PQITLWQRPIVTARIGGQLTEVLLDTGADDTVLENIDLPGKWKPKIIGGVGGFVKVRQYD
QIPIEVRGKTVIGTVLVGPTPFNIVGRNVMTKIGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005