<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
PL16925 71340 Portugal 2002 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ DDI NA
2 Unknown 61

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M L33LI, L89V L10V, I13A, K14KR, K20IV, A22AV, E35EG, M36I, R41RK, K55KR, L63P, I66FV, H69K, K70R, P79PA  
>71340| codons 1-99
PQITLWQRPVVTARIGGQLVEVLLDTGADDTVIEGINLPGKWKPKIIGGIGGFIRVRQYD
QIPIEVCGKRAIGTVLVGATPVNVIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, V75T, L210W, T215Y K219N Y181C   V35K, T39A, S68G, V118I, K122KQ, I135V, S162A, K173T, Q174K, D177E, T200A, E203K, Q207E, R211K, K223Q, P243S, V245E, T286A, E291D, V292I, I293V, P294T, S322A, I326V  
>71340| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALKEICAELEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLTDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DQDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPEIVI
CQYMDDLYVGSDLEIGQHRAKIKELREHLWKWGFYTPDNKHQQEPPFLWMGYELHPDKWT
VQSIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDIVTLTEEAE
LELAENREILKEPVHGVYYDPAKDLVAEIQKQGQ

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005