<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
GRSPR22 GRSPR22 Greece 2003 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V60I, V90G, V118I, K122V, K173T, Q174K, D177E, I178M, Q207E, R211RK, K238X P217Q
>GRSPR22| codons 38-243
CTEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEGQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDVDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRTKNPEMVIYQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTQ
DKKHQKEPPFLWMGYELHPDXWTVQP

References
Author Title Citation
Paraskevis, D Prevalence of resistance-associated mutations in newly diagnosed HIV-1 patients in Greece. Virus Res, 2005