<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA24964 CA57966 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 26
2 3TC+D4T+NFV 109
3 3TC+D4T+EFV 31
4 3TC+D4T+NVP 116

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N, Y181C   K43R, K122P, I135IT, S162C, D177E, T200A, H221HY, V245I, T286A, A288S K13KR
>CA57966| codons 1-300
PISPIETVPVKLRPGMDGPKVKQWPLTEEKIKALVEICTEMEREGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVI
CQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIILPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKSLTEVIPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L19Q, R57K, L63P  
>CA57965| codons 1-99
PQITLWQRPLVTIKVGGQQKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009