<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA16536 CA57862 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 52
2 3TC+DDC 74
3 3TC+D4T+NFV 87
4 D4T+DDI+EFV 52
5 D4T+DDI 268

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  A62AV, K70KN, V75T     K20R, V35L, S68SG, R83K, S162N, T165I, F214L, H221Y, V245Q, E248N, D250E, A272P, Q278H, K281R, T286A G262GR
>CA57862| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALLEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDGTNWRKLTDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQNSMIKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIQLPNKESWTVNDIQKLVRKLNWASQIYPGIKVKHLCRLLRGAKALTEVIPLTEEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, L90M   L10V, L19I, I64V, V77I, I93L  
>CA57861| codons 1-99
PQITLWQRPVVTIKIGGQIKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFIKVRQYD
QILVEICGHKAIGTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009