<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA14216 CA57822 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 35
2 None 113
3 3TC+AZT 18
4 3TC+D4T 35
5 3TC+D4T+IDV 135
6 3TC+D4T+SQV 126
7 3TC+D4T+EFV 144

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215Y   K103N V108VI E6D, K20R, R83K, A98S, K101Q, I135T, T200A, I293V, P294T, E297K  
>CA57822| codons 1-300
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPSGLQKNKSVTILDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVTLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A   N37S, I64V, V77I  
>CA57821| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLIGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009