<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA6406 CA57768 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 48
2 3TC+AZT 34
3 3TC+DDI 5
4 3TC+DDI+RTV 16
5 D4T+DDC+NFV 18
6 D4T+DDC+NVP 27
7 3TC+D4T+DDI+NFV+NVP 15
8 3TC+AZT+NFV+NVP 42
9 3TC+D4T+EFV+RTV+SQV 3
10 3TC+D4T+RTV+SQV 10
11 3TC+D4T+IDV+NFV 74
12 ABC+D4T+DDI 3
13 ABC+D4T+DDI+LPV 22
14 ABC+DDI+LPV+TDF 7
15 ABC+APV+DDI+LPV+TDF 72
16 3TC+D4T+IDV+RTV+TDF 130

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V, L210W, T215Y V75S, K219E K101E, Y181C, G190A V108I P4S, K20R, V35L, E44D, L109I, V118I, K122E, I135V, G196E, R211K, D218E, L228H, Q242H, S251IV, A272S, L283I, I293V V179Y
>CA57768| codons 1-300
PISSIETVPVKLKPGMDGPRVKQWPLTEEKIKALLEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSTRWRKISDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTIIDVGDAYFSIPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIYI
CQYVDDLYVASDLEIEQHRTKIEELRQHLWKWGFYTPEEKHQKEPPFHWMGYELHPDKWT
VHPIVLPEKDVWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLIRGTKALTEVVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54A, V82A, L90M K43T L10I, I62V, L63P, I64V, A71AV, I72IV, V77I  
>CA57767| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWTPKMIVGIGGFAKVRQYD
QVPVEICGHKVVGTVLIGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009