<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5235 CA57707 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+IDV 25
2 3TC+D4T+NFV 145
3 None 87
4 EFV+LPV+TDF 4
5 3TC+DDI+EFV+TDF 17
6 None 9
7 3TC+D4T+EFV+TDF 126

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M   I13V, R57K, I62V, L63P, A71V, T74A, V77I, I93L  
>CA57707| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVKQYD
QVPIEICGHKVIGAVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219E     E44D, V60I, V118I, I135M, S162Y, G196E, Q207D, R211K, V245E, A272P, I326V, A360T, K366R  
>CA57708| codons 1-367
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRDHLWKWGFYTPDEKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGT
HTNDVRQ

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009