<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5949 CA57703 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NRTI 52
2 3TC+AZT+RTV+SQV 26
3 3TC+APV+AZT+RTV 35
4 ABC+D4T+DDI+EFV 57
5 ABC+D4T+DDI 219

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84V, L90M   L10I, T31TA, I62IV, L63AV, A71V, I72V, V77I, I93L T26TA
>CA57703| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDAGADDAVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QVVIEICGHKVVGTVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69T_T, K70R K219Q K103KN A98G, V108I V35I, T39TA, K64N, K102KR, D121C, K122E, K166R, Q174QH, D177E, G196E, E203K, Q207E, R211K, F214FL, H221Y, L228N, V245T, A272P, K277R, I293V  
>CA57704| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAEMEKEGKISKIGPENPYNTPV
FAINKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKRNKSVTILDVGDAYFSVPL
CEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKHNPEIVI
YQYMDDLYVGSDLEIEQHRTKIKELREHLLKWGLTTPDQKYQKEPPFNWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTEEAE

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010