<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5471 CA57701 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 78
2 3TC+AZT 39
3 3TC+AZT+IDV 39
4 D4T+DDI+RTV+SQV 56
5 D4T+DDI+IDV+RTV 104
6 D4T+DDI+EFV 39
7 ABC+APV+DDI+LPV 74
8 Unknown 157

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82A L10F, L24I, L33F I13V, L19I, K55R, L63P, A71V, I93L, L97I  
>CA57701| codons 1-99
PQITLWQRPFVTVKIGGQIKEALIDTGADDTVFEEMNLPGRWKPKIIGGIGGFVRVRQYD
QIPIEICGHKVIGTVVVGPTPANIIGRNLLTQLGCTINF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70GRS, M184V, T215F K219Q K103KN   K20R, V60I, K122P, D177E, G196E, D218E, V245T, K277R, L283LI, T286A, A288S, I293V, P294T, E297K  
>CA57702| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTSWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGFFTPEQKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLIRGAKSLTEVVTLTKEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease mutations and protease inhibitor cross resistance. AAC, 2010