<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA2205 CA57677 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T 56
2 3TC+D4T+EFV+NFV 13
3 3TC+D4T+EFV 217
4 3TC+AZT 69

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    M36L, N37A, I62V, L63P, I64V, I72V  
>CA57677| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEELALPGRWKPKMIGGIGGFIKVRQYD
QVPVEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V   Y188L V179D K20KR, V35M, T39A, K102M, K103R, K122E, D123DN, I135T, Q174K, D177E, I202V, F214FL, V245M, A272S, L283I, T286A, A288S, I293V, E312K, D324E, Q334E, R356K, G359S, K390R, V435I, L469I, T470N, H483Y, Q507H, Q524E, V531I, A554S, K558R  
>CA57678| codons 1-560
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICAELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKMRKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKKNPEIDI
YQYVDDLLVGSDLEIGQHRTKVEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPEKDSWTVNDIQKLVGKLNWASQIYSGIKVKQLCKLIRGAKSLTEVVPLTEEAE
LELAENREILKKPVHGVYYDPSKELIAEIQKQGEGQWTYQIYQEPFKNLKTGKYAKMRSA
HTNDVKQLTEAVQKIATESIVIWGKTPKFRLPIQKETWEAWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIIGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSINDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIHAQPDKSESELVSQIIEELIKKEKIYLAWVPAHK
GIGGNEQVDKLVSSGIRRVL

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009