<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1590 CA57674 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 139
2 AZT+DDC+IDV 26
3 D4T+DDC+IDV 52
4 3TC+DDI+RTV+SQV 22
5 D4T+DDI+IDV+NFV 58
6 ABC+APV+NVP+RTV 309

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, L210W, T215Y K219N K101KE, Y181C, M230L   E44D, V60I, K66R, V118I, K122E, I135T, G196E, T200I, E203K, Q207D, H208Y, R211K, K223E, L228R, D237DE, A272P, T286P  
>CA57674| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPI
FAIKKRNSDKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIEQHRIKIKELRDYLWKWGFYTPDNKHQEEPPFRWLGYELHPEKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGPKALTEVIPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, I54V, V82L, L90M L33F, G73T, L89V L10I, V11L, T12E, I13V, Q18QH, L19M, M36I, R41K, L63P, A71V, V77I, I93L  
>CA57673| codons 1-99
PQITLWQRPILEVKIGGHMKEALLDTGADDTVFEEINLPGKWKPKIIGGVGGFVKVRQYD
QIPIEICGHKVITTVLIGPTPLNIIGRNVMTQLGCTLNF

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009