<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1467 CA57664 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 69
2 3TC+AZT+IDV 52
3 D4T+DDC+NFV 74
4 3TC+ABC+EFV+RTV+SQV 57
5 Unknown 270
6 LPV+NVP+SQV+TDF 13

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, Q151M, L210W, T215Y A62V, V75I, F116Y K103N, M230L V108I R83K, D123E, K166R, D177E, I202V, A272P, I293V, E297K  
>CA57664| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FVIKKKNSDKWRKLIDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYYSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTRILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKVEELRQHLWRWGFYTPDKKHQKEPPFLWLGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M L33F, F53L L10IV, K20R, E35D, M36I, R41K, L63P, A71V, I93L  
>CA57663| codons 1-99
PQITLWQRPVVTIKIGGQLREALLDTGADDTVFEDINLPGKWKPKLIGGIGGLVKVRQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012