<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1169 CA57652 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 226
2 AZT+DDC 35
3 3TC+AZT 44
4 3TC+AZT+SQV 22
5 3TC+AZT+NVP 17
6 3TC+D4T+NFV 15
7 3TC+D4T+RTV+SQV 37
8 3TC+D4T 36
9 3TC+D4T+IDV 225
10 Unknown 112

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, M184V, L210W D67G, V75M, F77L, T215H     T39X, K43KQ, E44D, A98S, K101Q, V111I, V118I, K122E, A158S, S162SDGN, I202IV, T286A, I293V, E297K  
>CA57652| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICXELEQDGKISKIGPENPYNTPV
FAIKKKGSDKWRKLMDLRELNKRTQDFWEVQLGIPHPSGLQKKKSVTVLDIGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQNSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKVEELRQHLWRWGFHTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTKEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M K43T, G73S L10IV, K20R, E35D, M36I, N37ND, Q61QR, I62V, L63P, A71V, I72EK, I93L, C95F  
>CA57651| codons 1-99
PQITLWQRPVVTIKIGGQLREALLDTGADDTVLEDIDLPGRWTPKIIGGIGGFVKVRQYD
RVPIEICGHKVKSTVLVGPTPANIIGRNLMTQLGFTLNF

References
Author Title Citation
Rhee, SY Genotypic predictors of human immunodeficiency virus type 1 drug resistance. PNAS, 2006
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012