<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7848 CA57650 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 230
2 AZT+DDI 9
3 3TC+D4T 90
4 D4T+DDI+NFV 132
5 3TC+ABC+APV 65
6 LPV+NVP+TDF 113
7 3TC+TDF 82

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69D, M184V, L210W, T215Y D67G, V75L, K219R V106A V108I, F227L E44D, V60I, V118I, K122E, D123E, I135T, I142V, Q174QR, I195IV, G196E, E203K, Q207E, H208Y, R211K, K223E, V245K, A272P, E297EK  
>CA57650| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPI
FAIKKKGSDKWRKLLDFRELNKRTQDFWEVQLGIPHPAGLKKKKSATILDVGDAYFSIPL
DEEFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKRNPDIVI
YQYVDDLYVGSDLEVEQHRTKIKELREYLWKWGFYTPDRKHQEEPPLLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, M36MI, I64V, C67W  
>CA57649| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QILVEIWGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012