<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5752 CA57615 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 52
2 D4T+DDI 17
3 D4T+DDI+IDV 61
4 3TC+AZT+NFV 133
5 D4T+IDV+NVP+RTV 84
6 3TC+APV+D4T+LPV 18
7 3TC+APV+D4T+LPV+TDF 113
8 3TC+ATV+DDI+LPV+TDF 55

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30DN N88D L10LI, I13IV, E35D, M36I, N37D, L63P, A71AT, I93L  
>CA57615| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADNTVLEDIDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLVGPTPVNIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184MV T215TAIV, K219Q K103N K238KT V35M, V60VI, I135IM, R211H, V245VM, D250DE, A272P, K281KR, A288AS, I293IV, E297EK  
>CA57616| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLHWGFVTPDQKHQKEPPFLWMGYELHPDTWT
VQPIMLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKSLTEVVPLTKEAE
L

References
Author Title Citation
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009