<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA7106 CA57607 U.S. 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC 139
2 D4T+DDI+EFV 44
3 3TC+D4T+DDI+NFV 9
4 3TC+DDI+NFV 69
5 3TC+DDI+NFV+RTV 168

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46I, I54L, L90M L33F, K43KT, N88D L19LI, I62V, L63P, I66L, A71T, I72IT, V77I, V82I, I93L  
>CA57607| codons 1-99
PQITLWQRPLVTIKIGGQIKEALLDTGADNTVFEEMNLPGRWTPKIIGGIGGFLKVRQYD
QVPIELCGHKTTGTVLIGPTPINIIGRDLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215Y       V118I, K122E, T200I, Q207E, E248EK, K277KR, Q278H, R284K, I293V, P294T, E297K S68SDGN
>CA57608| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDNTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRIKIEELREHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPKKDSWTVNDIQKLVGKLNWASQIYAGIKVRHLCKLLKGTKALTEVVTLTKEAE

References
Author Title Citation
Mitsuya, Y N88D facilitates the co-occurrence of D30N and L90M and the development of multidrug resistance in HIV type 1 protease following nelfinavir treatment failure. ARHR, 2006