<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ESH3097 ESH3097 Malawi 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 NVP NA
2 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, L19I, K20R, M36I, R41K, H69K, T74S, V77I, L89M, I93L  
>ESH3097| codons 1-99
PQITLWQRPLVTVKIEGQIREALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGSVLIGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103KN, Y188YC   V35T, E36A, T39E, S48T, K122E, K173AT, Q174N, D177E, T200A, Q207E, R211RK, V245HQ, E248ED, A272P, K277R, T286TA, E291D, V292I, I293V  
>ESH3097| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRANNPEIVI
YQYMDDLCVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIHLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQG

References
Author Title Citation
Eshleman, SH Nevirapine (NVP) resistance in women with HIV-1 subtype C, compared with subtypes A and D, after the administration of single-dose NVP. J Infect Dis, 2005