<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
98US_MSC3018 98US_3018 U.S. 1998 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, G16E, L19I, M36I, L63H, H69K, L89M, I93L  
>98US_3018| codons 1-99
PQITLWQRPLVSIKVEGQIKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QIHIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V21I, V35T, E36A, T39E, S48T, I135T, T165I, K173A, D177E, T200A, Q207E, R211K, V245Q, Y271F, A272S, K277R, E291D, V292I, I293V, H315Y, Q334H, G335D, R356K, G359T, T377M, K390R, A400T, T403A, E404D, W410Y, E432D, V435A, V466I, D471E, H483Q, L491S, S519N, E529G, K530R, A534S, A554K K13E
>98US_3018| codons 1-560
PISPIETVPVKLEPGMDGPKIKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIFSGIKVRQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVYGVYYDPSKDLIAEIQKQGHDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEAVQKIAMESIVIWGKTPKFRLPIQKETWETWWADYWQATYIPEWEFVNTP
PLVKLWYQLEKDPIAGAETFYVDGAANRETKLGKAGYVTDRGRQKIVSLTETTNQKTELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKGRVYLSWVPAHK
GIGGNEQVDKLVSKGIRKVL

References
Author Title Citation
Tovanabutra, S Characterization of complete HIV type 1 genomes from non-B subtype infections in U.S. military personnel. ARHR, 2005