<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
01NGPL644 01NGPL644 Nigeria 2001 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20V, M36I, R41K, K43R, H69K, L89I  
>01NGPL644| codons 1-99
PQITLWQRPLVTVRIGGQLVEALLDTGADDTVLEEINLPGKWRPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNILTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E53D, I135V, S162A, K173I, Q174K, D177E, I178M, T200A, Q207K, R211E, K238R, V245E  
>01NGPL644| codons 1-252
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPDNPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRIKNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELRKHLLEWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSW

References
Author Title Citation
Carr, JK HIV subtype and drug resistance patterns among drug-naive infected persons in Jos, Nigeria. Direct Genbank Submission, 2005