<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
01NGPL490 01NGPL490 Nigeria 2001 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, K20I, E35Q, M36I, R41K, R57K, L63S, C67E, H69K, V82I, L89M  
>01NGPL490| codons 1-99
PQITLWQRPIVTVRIGGQLIEALLDTGADDTVLEQINLPGKWKPKMIGGIGGFIKVKQYD
QISIEIEGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E36A, T39K, K43E, K122E, I135T, I142V, S162Y, K173A, D177E, V179I, E204Q, Q207E, R211K, F214L, V245K  
>01NGPL490| codons 1-252
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQYSMTKILEPFRAQNPEIII
YQYMDDLYVGSDLEIGQHRTKIEQLREHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSW

References
Author Title Citation
Carr, JK HIV subtype and drug resistance patterns among drug-naive infected persons in Jos, Nigeria. Direct Genbank Submission, 2005