<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
03UZ069 03UZ069 Uzbekistan 2003 HIV1 A PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, G16E, E35D, M36I, R41K, R57K, L63V, H69K, L89M, I93L  
>03UZ069| codons 1-99
PQITLWQRPLVTIRIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QIVIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V8I, V35T, E36D, T39K, K122E, D123S, A158S, K173L, Q174K, D177E, Q207A, R211S  
>03UZ069| codons 1-238
PISPIETIPVKLKPGMDGPKVKQWPLTEEKIKALTDICKEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRLKNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDK

References
Author Title Citation
Carr, JK Outbreak of west African recombinant of HIV-1 in Tashkent, Uzbekistan. JAIDS, 2005