<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
2602ND 2602ND Cameroon 2003 HIV1 CRF02_AG PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, M36L, N37D, R41K, H69K, K70R, L89M  
>2602ND| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEELDLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K20R, V35T, E36D, T39A, S162A, K173T, Q174N, D177E, T200A, Q207K R72K
>2602ND| codons 1-242
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTDICAEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWKKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTNNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRKHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQ

References
Author Title Citation
Carr, JK Outbreak of west African recombinant of HIV-1 in Tashkent, Uzbekistan. JAIDS, 2005