<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
pt-U ptUW52 U.S. 1996 HIV1 B PBMC MMC

Treatment History
Order Regimen Weeks
1 IDV 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82F, L90M   L10I, K14R, E35D, M36V, N37D, L63P, I64V, A71T, I93L  
>ptUW52| 6 | codons 1-99 | clone 6
PQITLWQRPIVTIRIGGQLKEALLDTGADDTVLEDVDLPGRWKPKMIGGIGGFVKVRQYD
QIPVEICGHKTIGTVLVGPTPFNIIGRNLMTQLGCTLNF
>ptUW52| 5 | codons 1-99 | clone 5
PQITLWQRPIVTIRIGGQLKEALLDTGADDTVLEDVDLPGRWKPKMIGGIGGFVKVRQYD
QIPVEICGHKTIGTVLVGPTPFNIIGRNLMTQLGCTLNF
>ptUW52| 4 | codons 1-99 | clone 4
PQITLWQRPIVTIRIGGQLKEALLDTGADDTVLEDVDLPGRWKPKMIGGIGGFVKVRQYD
QIPVEICGHKTIGTVLVGPTPFNIIGRNLMTQLGCTLNF
>ptUW52| 3 | codons 1-99 | clone 3
PQITLWQRPIVTIRIGGQLKEALLDTGADDTVLEDVDLPGRWKPKMIGGIGGFVKVRQYD
QIPVEICGHKTIGTVLVGPTPFNIIGRNLMTQLGCTLNF
>ptUW52| 2 | codons 1-99 | clone 2
PQITLWQRPIVTIRIGGQLKEALLDTGADDTVLEDVDLPGRWKPKMIGGIGGFVKVRQYD
QIPVEICGHKTIGTVLVGPTPFNIIGRNLMTQLGCTLNF
>ptUW52| 1 | codons 1-99 | clone 1
PQITLWQRPIVTIRIGGQLKEALLDTGADDTVLEDVDLPGRWKPKMIGGIGGFVKVRQYD
QIPVEICGHKTIGTVLVGPTPFNIIGRNLMTQLGCTLNF
>ptUW52| codons 1-99
PQITLWQRPIVTIRIGGQLKEALLDTGADDTVLEDVDLPGRWKPKMIGGIGGFVKVRQYD
QIPVEICGHKTIGTVLVGPTPFNIIGRNLMTQLGCTLNF

References
Author Title Citation
Condra, JH Genetic correlates of in vivo viral resistance to indinavir, a human immunodeficiency virus type 1 protease inhibitor. J Virol, 1996
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005