<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
YRG41 YRG41 India 2003 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, L19I, E21K, M36L, N37S, R41K, L63P, H69K, L89LM, I93L T26K
>YRG41| codons 3-99
ITLWQRPLVTVKVGGQIKKALLDKGADDTVLEELSLPGKWKPKMIGGIGGFIKVRQYDQI
PIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39E, S48T, V60I, D121H, K122E, I135T, S162Y, K173T, D177E, T200A, Q207G  
>YRG41| codons 1-243
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRTQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRGHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQP

References
Author Title Citation
Balakrishnan, P HIV type 1 genotypic variation in an antiretroviral treatment-naive population in southern India. ARHR, 2005