<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 IDV+ RTI 21
2 RTV+ RTI 34
3 SQV+ NFV+ RTI 35
4 SQV+ RTV+ RTI 29
5 SQV+ NFV+ RTI 46
6 LPV+NRTI+NVP 70

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I47IV, I54V, V82A, L90M L33F, F53L, G73S T4TP, L10IV, I13V, K14R, K20R, E34EV, E35D, M36I, R41K, K55KR, D60E, Q61G, I62V, L63P, A71V  
>6373_d493| codons 1-99
PQITLWQRPIVTVRIGGQLREALLDTGADDTVFEDINLPGKWKPKMIGGIGGLVKVRQYE
GVPIEICGHKVISTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70G, Y115F, Q151M, M184I, T215Y A62V, V75I, F77L, F116Y K103N, Y188H   P1L, K20R, T58N, S68N, K101KQ, K122E, I135T, I167IV, V179I, I202V, L210LS, R211K, T286A, E297K  
>6373_d493| codons 1-311
LISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNNPV
FVIKKKNNTGWRKLIDLRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAFYSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYIDDLHVGSDLEIGQHRTKVEELRQHLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTKEAE
LELAENREILK

References
Author Title Citation
Kempf, DJ Identification of genotypic changes in human immunodeficiency virus protease that correlate with reduced susceptibility to the protease inhibitor lopinavir among viral isolates from protease inhibitor-experienced patients. J Virol, 2001