<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 SQV+ RTI 9
2 IDV+ RTI 81
3 SQV+ RTV+ RTI 32
4 IDV+ NFV+ RTI 28
5 LPV+NRTI+NVP 20

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46LV, I54V, V82A L24I, F53FL L10I, T12D, K14R, I15V, K20R, E35D, M36I, R41K, L63P, H69K, K70R, A71V  
>6360_d142| codons 1-99
PQITLWQRPIVDIRVGGQLREALIDTGADDTVLEDINLPGKWKPKLIGGIGGFVKVRQYD
QIPIEICGKRVIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F K219E K103N V108VI, K238KT K11KT, V35T, T39K, K43Q, V60I, V118I, D121H, K122E, I135V, K173T, Q174K, D177E, T200A, Q207E, R211K, F214L, V241VM, V245Q, E248D, D250E, A272P, K275R, Q278N, T286A, A288V, V292I, E297A  
>6360_d142| codons 1-311
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKELEQEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
HEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGLFTPDEKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKESWTVNDIQKLVGKLNWASQIYPGIRVKNLCKLLRGAKVLTEIIPLTAEAE
LELAENREILK

References
Author Title Citation
Kempf, DJ Identification of genotypic changes in human immunodeficiency virus protease that correlate with reduced susceptibility to the protease inhibitor lopinavir among viral isolates from protease inhibitor-experienced patients. J Virol, 2001