<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NFV+ RTI 19
2 LPV+NRTI+NVP 15

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, E35D, N37CS, R41K, I62V, L63P, A71T  
>8371_d105| codons 1-99
PQITLWQRPLVTVKVGGQLKEALLDTGADDTVLEDMCLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGHKTIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103KN, G190A   V35I, I135T, R211K, V245K, T286A, E297K, K311KR, I326IV, Q334L, T377Q, K390R, K395KN, A400AV  
>8371_d105| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVASDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTKEAE
LELAENREILREPVHGVYYDPSKDLVAEIQKQGLGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKIAQESIVIWGKTPKFRLPIQKETWEA

References
Author Title Citation
Kempf, DJ Identification of genotypic changes in human immunodeficiency virus protease that correlate with reduced susceptibility to the protease inhibitor lopinavir among viral isolates from protease inhibitor-experienced patients. J Virol, 2001