<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 SQV+ RTI 41
2 RTV+ RTI 26
3 IDV+ RTI 34
4 SQV+ NFV+ RTI 38
5 LPV+NRTI+NVP 72

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82S, L90M L10F L19R, K20IMV, E34K, M36I, R41K, D60E, I62V, L63P, H69HQ, A71V, V77I, I93L  
>6357_d506| codons 1-99
PQITLWQRPFVTIKIGGQRIEALLDTGADDTVLKEINLPGKWKPKMIGGIGGFVKVRQYE
QVPIEICGHKVIGTVLIGPTPSNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74LV, T215Y   G190S V179E P4PST, K20KR, K82KR, K122E, I135V, S163SC, R211S, S251H, K277KR, T286A  
>6357_d506| codons 1-311
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIEI
YQYMDDLYVSSDLEIGQHRTKIEELRQHLLSWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDHWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVIPLTEEAE
LELAENREILK

References
Author Title Citation
Kempf, DJ Identification of genotypic changes in human immunodeficiency virus protease that correlate with reduced susceptibility to the protease inhibitor lopinavir among viral isolates from protease inhibitor-experienced patients. J Virol, 2001