<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NFV+ RTI 133
2 LPV+NRTI+NVP 24

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74V, M184V, T215Y V75A G190C   E36EQ, K73M, R83K, K101Q, V118I, D123G, I178L, V189VI, T286TA, I293V, E297A, D324E, R358K K49T
>8362_d168| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISTIGPENPYNTPV
FAIKKKDSTKWRMVADFRELNKKTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSIPL
DKGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
YQYVDDLYVCSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMKGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54IV, L76V, L90M L33F, N88G L10I, I13V, Q18H, N37D, Q61H, L63P, A71L, I72T, V77I, I93IL  
>8362_d168| codons 1-99
PQITLWQRPIVTVKIGGHLKEALLDTGADDTVFEEMDLPGRWKPKIIGGIGGFVKVRQYD
HIPIEICGHKLTGTVVIGPTPVNIIGRGLMTQLGCTLNF

References
Author Title Citation
Kempf, DJ Identification of genotypic changes in human immunodeficiency virus protease that correlate with reduced susceptibility to the protease inhibitor lopinavir among viral isolates from protease inhibitor-experienced patients. J Virol, 2001