<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 RTV+ RTI 17
2 RTV+ IDV+ RTI 17
3 IDV+ RTI 38
4 LPV+NRTI+NVP 11

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y V75M L100I, K103N A98G V35M, T39A, K43E, E44D, V118I, K122E, I178L, R211K, A272P, T286A, V292VI, E297EAKT  
>6372_d83| codons 1-400
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEEDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHPGGIKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M K43T, F53L L10I, K20R, E35D, M36I, N37NT, R41RK, I62V, L63P, A71V  
>6372_d83| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDINLPGRWTPKMIGGIGGLVKVRQYD
QVPIEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Kempf, DJ Identification of genotypic changes in human immunodeficiency virus protease that correlate with reduced susceptibility to the protease inhibitor lopinavir among viral isolates from protease inhibitor-experienced patients. J Virol, 2001
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012