<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 RTI+ SQV 26
2 RTI+ IDV 48
3 RTV+ SQV+ RTI 107
4 LPV+NRTI+NVP 89

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V K70T, V75I   V108I V21I, W88S, D123E, D177E, I178L, G196E, V245E, D250E, A272P, K281R, A288S, P294S, E297K Q85QL
>6335_d629| codons 1-311
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTTWRKLIDFRELNKRTQDFSEVQLGIPHPAGLKKKKSVTILDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPELVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKSLTEVISLTKEAE
LELAENREILK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, M36I, R41K, L63P, E65D, K70R  
>6335_d629| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPIDICGHRAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Kempf, DJ Identification of genotypic changes in human immunodeficiency virus protease that correlate with reduced susceptibility to the protease inhibitor lopinavir among viral isolates from protease inhibitor-experienced patients. J Virol, 2001
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012