<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 PI+ NRTI NA
2 LPV+ NVP+ NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, Q151M, M184V V75I, F77L, F116Y, T215V, K219Q Y181C, G190GA   K20R, K49R, T69N, K101Q, S162D, K166R, G196E, I202V, Q207E, R211RK, H221HY, A272P, A288AS, E297EK  
>9124_d164| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISRIGPENPYNTPV
FAIKKKNSNRWRKLIDLRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYYSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQDSMTRILEPFRKQNPDIVI
CQYVDDLYVGSDLEIEQHRTKVEELREHLLRWGFVTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54S, V82A   L10I, E34Q, I62V, L63P, A71V, I72V, T74S, V77I, I93L  
>9124_d164| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLQEMNLPGRWKPKMIVGIGGFSKVRQYD
QVPIEICGHKVVGSVLIGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Mo, H Selection of resistance in protease inhibitor-experienced, human immunodeficiency virus type 1-infected subjects failing lopinavir- and ritonavir-based therapy: mutation patterns and baseline correlates. J Virol, 2005