<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
9172 9172_d1 U.S. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI+ NRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, L90M   L10V, I13V, I15V, G16A, K20T, K55R, I62V, L63P, I66F, A71T, I72LM, V77I  
>9172_d1| codons 1-99
PQITLWQRPVVTVKVAGQLTEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFIRVRQYD
QVPIEFCGHKTLGTVLIGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210LW, T215Y       T39TA, D121Y, K122E, I135T, I142IT, Q174QK, T200A, R211RK, V245EK, A272P  
>9172_d1| codons 1-311
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILK

References
Author Title Citation
Mo, H Selection of resistance in protease inhibitor-experienced, human immunodeficiency virus type 1-infected subjects failing lopinavir- and ritonavir-based therapy: mutation patterns and baseline correlates. J Virol, 2005