<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
04MYKL1663 04_1663 Malaysia 2004 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F L10I, I13V, M36I, R41K, I62V, H69K, K70R, L89M  
>04_1663| codons 1-95
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVFEEINLPGKWKPKMIGGIGGFIKVRQYD
QVLIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGC

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39K, K43E, K122E, D123S, I135T, I142V, K173I, Q174K, D177E, T200I, Q207A, R211S, K238R, V245E  
>04_1663| codons 20-254
KVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNET
PGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVIYQYMDDLYVGSDLEIGQHR
IKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWTVQPIELPEKDSWTV

References
Author Title Citation
Tee, KK Emergence of HIV-1 CRF01_AE/B unique recombinant forms in Kuala Lumpur, Malaysia. AIDS, 2005