<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
03MYKL1362 03_1362 Malaysia 2003 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, G16E, E35D, M36I, R41K, L63V, H69K, K70R, L89M  
>03_1362| codons 1-95
PQITLWQRPVVTVKIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIVIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGC

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T27P, V35T, T39K, K43E, K122E, D123S, K173I, Q174K, D177E, I178M, T200I, Q207A, R211S, L228N, K238R, V245E  
>03_1362| codons 20-254
KVKQWPLPEEKIKALTEICKEMEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNET
PGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMVIYQYMDDLYVGSDLEIGQHR
IKIEELRAHLLSWGFTTPDKKHQKEPPFNWMGYELHPDRWTVQPIELPEKDSWTV

References
Author Title Citation
Tee, KK Emergence of HIV-1 CRF01_AE/B unique recombinant forms in Kuala Lumpur, Malaysia. AIDS, 2005