<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
WJ_pat7101 7101_W24 U.S. 2002 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 TDF+ 3TC+ EFV 23

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, M184V A62AV V106M V179D E6D, V21VD, S68SN, D123E, I178L, E194EK, G196E, T200I, R211RK, F214L, V245T, K249Q, K275R, V276I, I293V, P294Q  
>7101_W24| codons 1-297
PISPIDTVPVKLKPGMDGPKDKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKRKDNTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSMTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLDI
YQYVDDLYVGSDLKIEQHRIKIEELRQHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEQDSWTVNDIQKLVGKLNWASQIYAGIRIKQLCKLLRGTKALTEVVQLTE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37S, R41K, L63P, I72V, V77VI  
>7101_W24| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAVGTVLIGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Weber, J Diminished replicative fitness of primary human immunodeficiency virus type 1 isolates harboring the K65R mutation. J Clin Microbiol, 2005