<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
WJ_pat7101 7101_W12 U.S. 2002 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 TDF+ 3TC+ EFV 12

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V   V106M V179D E6D, D123E, I178L, G196E, T200I, F214L, V245T, K249Q, K275R, V276I, I293V, P294Q  
>7101_W12| codons 1-297
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSMTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLDI
YQYVDDLYVGSDLEIEQHRIKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEQDSWTVNDIQKLVGKLNWASQIYAGIRIKQLCKLLRGTKALTEVVQLTE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37T, R41K, L63P, I72IV  
>7101_W12| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMTLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Weber, J Diminished replicative fitness of primary human immunodeficiency virus type 1 isolates harboring the K65R mutation. J Clin Microbiol, 2005