<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
WJ_pat7152 7152_W36 U.S. 2002 HIV1 B PBMC None

Treatment History
Order Regimen Weeks
1 D4T+ 3TC+ EFV 35

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, T69~, K70R   V106M V179D K20R, V35L, K43S, I50V, R83K, D121H, K122E, E169D, D177E, F214L, E248D, A272P, K277R, T286A  
>7152_W36| codons 1-298
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALLEICTEMESEGKISKVGPENPYNTPV
FAIKRKDS~RWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSMTVLDVGDAYFSVPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPEIDI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTEE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    M36I, L63P  
>7152_W36| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Weber, J Diminished replicative fitness of primary human immunodeficiency virus type 1 isolates harboring the K65R mutation. J Clin Microbiol, 2005