<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DP_108 DP_108m3 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 TDF+ DDI+ EFV 13

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  K219N G190E   V60I, K101R, D121H, K122E, Q174K, D177E, R211K  
>DP_108m3| codons 1-267
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLRKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKKNPEIVI
YQYMDDLYVESDLEIGQHRTKIEELRQHLLKWGFTTPDNKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, P39S, L63P, I64L, A71V, I72V, V77I, I93L  
>DP_108m3| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDMNLSGRWKPKMIGGIGGFIKVRQYD
QIPLEICGHKVVGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Podzamczer, D Early virological failure with a combination of tenofovir, didanosine and efavirenz. Antivir Ther, 2005