<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DP_401 DP_401m5 Spain 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 TDF+ DDI+ EFV 21

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, L63V, V77I, N83NY  
>DP_401m5| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIVIEICGHKAIGTVLIGPTPVYIIGRNLLTQIGCTLNF

References
Author Title Citation
Podzamczer, D Early virological failure with a combination of tenofovir, didanosine and efavirenz. Antivir Ther, 2005