<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DP_111 DP_111m3 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 TDF+ DDI+ EFV 13

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74LV   K103KN, G190S Y188YF V35I, R83K, K101KR, S162A, G196E, Q207E, V245E, E248D, S251I, V276VI, Q278QH, T286A, E297EK, I329L  
>DP_111m3| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKKTQDFWEVQLGIPHPAGLRKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPDIVI
YQYMDDLFVSSDLEIEQHRTKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPDKDIWTVNDIQKLVGKLNWASQIYAGIKIKHLCKLLRGAKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12K, G17E, L19I, L63P, Q92QK, I93IL  
>DP_111m3| codons 1-99
PQITLWQRPLVKIKIGEQIKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLVGPTPVNIIGRNLLTKLGCTLNF

References
Author Title Citation
Podzamczer, D Early virological failure with a combination of tenofovir, didanosine and efavirenz. Antivir Ther, 2005