<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
DP_115 DP_115m3 Spain 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 TDF+ DDI+ EFV 13

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, T69D, L74LV   L100I, K103N V108I V35I, S68G, V118I, K122D, T200L, F214L, K249Q, D250E, I326V  
>DP_115m3| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKRKDGDKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTILDVGDAYFSIPL
DDDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRLKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEQESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, K14T, L19Q, E35D, M36I, L63T  
>DP_115m3| codons 1-99
PQITLWQRPIVTITIGGQQKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QITIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Podzamczer, D Early virological failure with a combination of tenofovir, didanosine and efavirenz. Antivir Ther, 2005