<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Gh_K27 Gh_K27 Ghana 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, L19P, K20I, M36I, N37D, R41K, I64M, H69K, K70R, L89M  
>Gh_K27| codons 4-96
TLWQRPIVTVRIGGQPIEALLDTGADDTVLEEIDLPGKWKPKMIGGIGGFIKVRQYDQIL
MEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCT

References
Author Title Citation
Kinomoto, M HIV-1 proteases from drug-naive West African patients are differentially less susceptible to protease inhibitors. Clin Infect Dis, 2005