<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
01PB1ZA 01PB1ZA South Africa 2001 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      Y318F V35T, E36A, T39E, E40D, S48T, V60I, K102Q, V118I, K122E, I135T, E138A, K173I, Q174K, T200A, Q207E, L210V, F214L, V245Q, E248D, S251C, A272P, K275R, K277R, Q278H, T286A, E291D, V292I, I293V  
>01PB1ZA| codons 9-318
PVKLKPGMDGPKVKQWPLTEEKIKALTAICEDMEKEGKITKIGPENPYNTPIFAIKKKDS
TKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSIPLDEDFRKYT
AFTIPSTNNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPDIVIYQYMDDLY
VGSDLEIGQHRAKIEELREHLVRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIQLPD
KDCWTVNDIQKLVGKLNWASQIYPGIRVRHLCKLLRGAKALTDIVPLTEEAELELAENRE
ILKEPVHGVF

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, L19I, M36L, R41K, D60E, L63P, H69K, I93L  
>01PB1ZA| codons 2-99
QITLWQRPLVSIKIGGQIKEALLDTGADDTVLEELNLPGKWKPKMIGGIGGFIKVRQYEQ
IPIEICGKKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Bessong, PO Characterization of human immunodeficiency virus type 1 from a previously unexplored region of South Africa with a high HIV prevalence. ARHR, 2005