<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
01PB27ZA 01PB27ZA South Africa 2001 HIV1 C PBMC None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T27S, V35T, T39E, S48T, V60I, V118I, K122E, D123N, E138A, K173A, D177E, T200A, E204K, Q207E, R211K, E224D, V245K, A272S, K277R, Q278E, T286A, E291D, V292I, I293V  
>01PB27ZA| codons 10-315
VKLKPGMDGPKVKQWPLSEEKIKALTEICEEMEKEGKITKIGPENPYNTPIFAIKKKDST
KWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPLDENFRKYTA
FTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVIYQYMDDLYV
GSDLEIGQHRAKIEKLREHLLKWGFTTPDKKHQKDPPFLWMGYELHPDKWTVQPIKLPEK
DSWTVNDIQKLVGKLNWASQIYSGIKVRELCKLLRGAKALTDIVPLTEEAELELAENREI
LKEPVH

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19T, K20R, E35D, M36I, N37E, R41K, D60E, H69K, L89M, I93L  
>01PB27ZA| codons 2-99
QITLWQRPLVSIKVGGQTREALLDTGADDTVLEDIELPGKWKPKMIGGIGGFIKVRQYEQ
ILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Bessong, PO Characterization of human immunodeficiency virus type 1 from a previously unexplored region of South Africa with a high HIV prevalence. ARHR, 2005